PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 360aa    MW: 40255.7 Da    PI: 8.8122
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08560.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-53161441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +++ewyfFs+rd+ky++g+r+nra++sgyWkatg+dk++l++  ++
  KHN08560.1  16 LPPGFRFHPTDEELVVQYLKKKADSVPLPV-SIIAEVDLYKFDPWELPSKATFGDQEWYFFSPRDRKYPNGTRPNRAATSGYWKATGTDKPILAShgHH 113
                 79****************************.89***************988899***************************************997777 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kk+Lvfy g+ pkg+kt+W+mheyrl
  KHN08560.1 114 NKVGVKKSLVFYGGKPPKGVKTNWIMHEYRL 144
                 78***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-6311184IPR003441NAC domain
PROSITE profilePS5100560.98916184IPR003441NAC domain
PfamPF023651.3E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MDSSSSGSQF SQHPQLPPGF RFHPTDEELV VQYLKKKADS VPLPVSIIAE VDLYKFDPWE  60
LPSKATFGDQ EWYFFSPRDR KYPNGTRPNR AATSGYWKAT GTDKPILASH GHHNKVGVKK  120
SLVFYGGKPP KGVKTNWIMH EYRLADSSSN SSSKPPSSAS DHAHSGKKNS LRLDDWVLCR  180
IYKKSNSTHL PRLPLMEQNK EISREISMLP MMSTLSMAND NNTPQDSKTA SSRSTSYGPL  240
GVENDDNFFD GIFGVDHQSM QQDVSDHSQQ VSSKGNFPMK RELSSQFWNG TGSSSSSRQF  300
HYDLNYAGNS TTVEEDNSFV SLLSHLPQNT TTFHPNALLG PVGNGVLRQQ FQLPSMNWNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-731618920173NAC domain-containing protein 19
3swm_B6e-731618920173NAC domain-containing protein 19
3swm_C6e-731618920173NAC domain-containing protein 19
3swm_D6e-731618920173NAC domain-containing protein 19
3swp_A6e-731618920173NAC domain-containing protein 19
3swp_B6e-731618920173NAC domain-containing protein 19
3swp_C6e-731618920173NAC domain-containing protein 19
3swp_D6e-731618920173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541742.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ8GY421e-109NAC25_ARATH; NAC transcription factor 25
TrEMBLK7M1M90.0K7M1M9_SOYBN; Uncharacterized protein
STRINGGLYMA13G31660.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-103NAC domain containing protein 25